PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.O00333.1.p
Common NameMIMGU_mgv11b020310mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 112aa    MW: 12543.9 Da    PI: 6.5082
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.O00333.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB53.84.6e-1716664494
             NF-YB 44 sfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                      sfvt+ea+  c+r+ r t++++d+l a+a+lG++dy+epl+++l+k+r  +
  Migut.O00333.1.p 16 SFVTAEANGWCNRDYRSTVTPEDVLAAMASLGLDDYLEPLTLFLNKHRAEQ 66
                      9**********************************************9754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.9E-161673IPR009072Histone-fold
SuperFamilySSF471131.82E-131674IPR009072Histone-fold
PRINTSPR006151.3E-52644No hitNo description
PRINTSPR006151.3E-54563No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MPPTFRSPHR TLSANSFVTA EANGWCNRDY RSTVTPEDVL AAMASLGLDD YLEPLTLFLN  60
KHRAEQNSEQ GSMNFLPQFV RQGGDADASI GFIDTQQPQR THTVHRSTKY W*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012839452.16e-53PREDICTED: nuclear transcription factor Y subunit B-9-like
SwissprotQ84W662e-15NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A022RVM32e-80A0A022RVM3_ERYGU; Uncharacterized protein
STRINGPOPTR_0016s00740.14e-15(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.26e-17nuclear factor Y, subunit B6